Peptides

Glucagon-Like Peptide-2, GLP-2 (1-33), human - 1 mg

279.00
Check your price
  • Cat.Number : AS-62070
  • Availability :
    In stock

Quantity

This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.

Specifications

Chemistry
Sequence one letter code
  • HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Sequence three letter code
  • H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH
CAS registry number
  • 223460-79-5
Molecular Formula
  • C165H254N44O55S
Molecular Mass/ Weight
  • 3766.4
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of Exendin-4 peptide

Exendin 4

Cat.Number : AS-24463
182.00 Excl. Tax
Tube of GIP peptide, rat

GIP, rat

Cat.Number : AS-65568-05
198.00 Excl. Tax
Image of a kit SensoLyte 520 IDE Activity Assay Kit Fluorimetric

SensoLyte® 520 IDE Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72231
509.00 Excl. Tax