Peptides

LL-37, reverse sequence - 0.5 mg

146.00
Check your price
  • Cat.Number : AS-62208
  • Availability :
    In production

Select specification

Quantity

The reverse sequence of LL-37

Specifications

Chemistry
Sequence one letter code
  • SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Sequence three letter code
  • H-Ser-Glu-Thr-Arg-Pro-Val-Leu-Asn-Arg-Leu-Phe-Asp-Lys-Ile-Arg-Gln-Val-Ile-Arg-Lys-Phe-Glu-Lys-Gly-Ile-Lys-Glu-Lys-Ser-Lys-Arg-Phe-Phe-Asp-Gly-Leu-Leu-OH
Molecular Formula
  • C205H340N60O53
Molecular Mass/ Weight
  • 4493.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
309.00 Excl. Tax