Peptides

LL-37, scrambled - 1 mg

309.00
Check your price
  • Cat.Number : AS-63708
  • Availability :
    In stock

Select specification

Quantity

The scrambled sequence of LL-37

Specifications

Chemistry
Sequence one letter code
  • GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Sequence three letter code
  • Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg
Molecular Formula
  • C205H340N60O53
Molecular Mass/ Weight
  • 4493.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
309.00 Excl. Tax

Citations

Clostridium difficile clinical isolates exhibit variable susceptibility and proteome alterations upon exposure to mammalian cationic antimicrobial peptides.

Anaerobe . 2012 Sep 24 ; 18(6) 614 | DOI : 10.1074/jbc.M110.206110

  • R. McQuade
  • et al

Hormonally active vitamin D3 (1α,25-Dihydroxycholecalciferol) triggers autophagy in human macrophages that inhibits HIV-1 infection.

JBC . 2011 Mar 30 ; 286(21) 18890 | DOI : 10.1074/jbc.M110.206110

  • GR. Campbell
  • SA. Spector

The Alzheimer’s Disease-Associated Amyloid b-Protein Is an Antimicrobial Peptide.

PLoS One . 2010 Mar 03 ; 5(3) e9505 | DOI : 10.1371/journal.pone.0009505.

  • S. Soscia
  • et al