Peptides

Pancreatic Polypeptide, human

112,00
Check your price
  • Cat.Number : AS-22866
  • Availability :
    In stock

Size

Quantity

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).

Specifications

Chemistry
Sequence one letter code
  • APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Sequence three letter code
  • H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
CAS registry number
  • 75976-10-2
Molecular Formula
  • C185H287N53O54S2
Molecular Mass/ Weight
  • 4181.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Tube of Glucagon (1-29) peptide

Glucagon (1-29), bovine, human, rat, porcine

Cat.Number : AS-22456
66,00
Tube of Somatostatin-28 peptide

Somatostatin 28, human, sheep, cow, rat, mouse, pig

Cat.Number : AS-22901
102,00