Peptides

PDKtide - 1 mg

373.00
Check your price
  • Cat.Number : AS-64225
  • Availability :
    In stock

Quantity

This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).

Specifications

Chemistry
Sequence one letter code
  • [protein fragment, 39 aa]
Sequence three letter code
  • H-Lys-Thr-Phe-Cys-Gly-Thr-Pro-Glu-Tyr-Leu-Ala-Pro-Glu-Val-Arg-Arg-Glu-Pro-Arg-Ile-Leu-Ser-Glu-Glu-Glu-Gln-Glu-Met-Phe-Arg-Asp-Phe-Asp-Tyr-Ile-Ala-Asp-Trp-Cys-OH
Molecular Formula
  • C212H314N54O66S3
Molecular Mass/ Weight
  • 4771.6
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Application
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of CREBtide peptide, 5-FAM

CREBtide [KRREILSRRPSYR], 5-FAM labeled

Cat.Number : AS-60436-1
246.00 Excl. Tax
Tube of Glasstide peptide, PKG substrate

PKG Substrate [RKRSRAE], Glasstide

Cat.Number : AS-60298-1
88.00 Excl. Tax