Peptides

PEP1 - 1 mg

291.00
Check your price
  • Cat.Number : AS-60430-1
  • Availability :
    In production

Quantity

This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.

Specifications

Chemistry
Sequence one letter code
  • SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Sequence three letter code
  • Ser-Gly-Ser-Trp-Leu-Arg-Asp-Val-Trp-Asp-Trp-Ile-Cys-Thr-Val-Leu-Thr-Asp-Phe-Lys-Thr-Trp-Leu-Gln-Ser-Lys-Leu-Asp-Tyr-Lys-Asp-NH2
Molecular Formula
  • C177H259N43O49S
Molecular Mass/ Weight
  • 3805.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • HCV
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of HCV NS3/4A Protease Substrate peptide

HCV NS3/4A Protease Substrate - 1 mg

Cat.Number : AS-60798
710.00 Excl. Tax
Image of a kit SensoLyte 520 HCV Protease Assay Kit Fluorimetric

SensoLyte® 520 HCV Protease Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-71145
465.00 Excl. Tax