Peptides

Prostatic Acid Phosphatase (248-286), PAP (248-286) - 1 mg

330.00
Check your price
  • Cat.Number : AS-64518
  • Availability :
    In stock

Quantity

Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.

Specifications

Chemistry
Sequence one letter code
  • GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
Sequence three letter code
  • H-Gly-Ile-His-Lys-Gln-Lys-Glu-Lys-Ser-Arg-Leu-Gln-Gly-Gly-Val-Leu-Val-Asn-Glu-Ile-Leu-Asn-His-Met-Lys-Arg-Ala-Thr-Gln-Ile-Pro-Ser-Tyr-Lys-Lys-Leu-Ile-Met-Tyr-OH
Molecular Formula
  • C203H342N60O54S2
Molecular Mass/ Weight
  • 4551.7
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Human, gorilla
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

IMG-EN-AS-61017-10-01.JPG

HCV NS3/4A protease genotype 1b, recombinant

Cat.Number : AS-61017-5
246.00 Excl. Tax
Image of a kit SensoLyte 520 HIV Protease Assay Kit Fluorimetric

SensoLyte® 520 HIV Protease Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-71147
465.00 Excl. Tax