Peptides

Tat-Beclin-1 - 1 mg

180,00
Check your price
  • Cat.Number : AS-65467
  • Availability :
    In production

Select specification

Quantity

Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy.

Specifications

Chemistry
Sequence one letter code
  • YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Sequence three letter code
  • Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH
Molecular Formula
  • C164H251N57O45
Molecular Mass/ Weight
  • 3741.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)