Peptides

TIP 39, Tuberoinfundibular Neuropeptide, Parathyroid Hormone 2 Receptor Agonist - 1 mg

390,00
Check your price
  • Cat.Number : AS-21687
  • Availability :
    In production

Quantity

This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.

Specifications

Chemistry
Sequence one letter code
  • SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Sequence three letter code
  • H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH
CAS registry number
  • 277302-47-3
Molecular Formula
  • C202H325N61O54S
Molecular Mass/ Weight
  • 4504.3
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, bovine

You may also be interested in the following product(s)

Tube of (Gla17,21,24)-Osteocalcin (1-49) peptide

[Gla17,21,24]-Osteocalcin (1-49)

Cat.Number : AS-22829
117,00
Tube of Calcitonin peptide, human

Calcitonin, human

Cat.Number : AS-20673
126,00

Citations

TIP39/Parathyroid Hormone Type 2 Receptor Signaling is a Potent Inhibitor of Chondrocyte Proliferation and Differentiation

Am J Physiol Endocrinol Metab. . 2009 Aug 25 ; 297(5) E1125 | DOI : 10.1152/ajpendo.00254.2009

  • D. Panda
  • et al

Thrombospondin-1-induced Focal Adhesion Disassembly in Fibroblasts Requires Thy-1 Surface Expression, Lipid Raft Integrity, and Src Activation

J Biol Chem.  . 2004 Mar 18 ; 279(22) 23510 | DOI : 10.1074/jbc.M402169200

  • TH. Barker
  • et al

Agonist-specific regulation of parathyroid hormone (PTH) receptor type 2 activity: structural and functional analysis of PTH- and tuberoinfundibular peptide (TIP) 39-stimulated desensitization and internalization.

Mol Endocrinol. . 2004 Feb 26 ; 18(6) 1486 | DOI : 10.1210/me.2003-0487

  • Alessandro Bisello
  • et al

Centrally Administered Tuberoinfundibular Peptide of 39 Residues Inhibits Arginine Vasopressin Release in Conscious Rats

Endocrinology. . 2003 Jul 01 ; 144(7) 2791 | DOI : 10.1210/en.2002-0017

  • Y. Sugimura
  • et al

Evaluating the Signal Transduction Mechanism of the Parathyroid Hormone 1 Receptor: EFFECT OF RECEPTOR-G-PROTEIN INTERACTION ON THE LIGAND BINDING MECHANISM AND RECEPTOR CONFORMATION*

JBC . 2001 Mar 16 ; 276 7741 | DOI : 10.1074/jbc.M009395200

  • SRJ. Hoare
  • et al

Structure of Tuberoinfundibular Peptide of 39 Residues

JBC . 2000 Aug 25 ; 275(35) 27284 | DOI : 10.1074/jbc.M003869200

  • A. Piserchio
  • et al

Molecular determinants of tuberoinfundibular peptide of 39 residues (TIP39) selectivity for the parathyroid hormone-2 (PTH2) receptor. N-terminal truncation of TIP39 reverses PTH2 receptor/PTH1 receptor binding selectivity.

JBC . 2000 Sep 01 ; 275(35) 27274 | DOI : 10.1074/jbc.M003910200

  • SRJ. Hoare
  • et al