Peptides

Adrenomedullin (22-52), human - 0.5 mg

167,00
Check your price
  • Cat.Number : AS-60449
  • Availability :
    In stock

Select specification

Quantity

AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.

Specifications

Chemistry
Sequence one letter code
  • TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence three letter code
  • H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
CAS registry number
  • 159899-65-7
Molecular Formula
  • C159H252N46O48
Molecular Mass/ Weight
  • 3576
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Citations

Pathogenesis of Pancreatic Cancer Exosome-Induced Lipolysis in Adipose Tissue.

Gut . 2015 Apr 28 ; 65(7) 1165 | DOI : 10.1136/gutjnl-2014-308350

  • G. Sagar
  • et al

The role of nitric oxide and potassium channels in the effect of adrenomedullin in human internal thoracic arteries.

Regul Pept . 2010 Jan 14 ; 161(1-3) 92 | DOI : 10.1016/j.regpep.2009.12.023

  • Z. Bayram