Catalog

    1 - 20 of 131

    [Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4 - 50 µg

    C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

    [Met]-beta-Amyloid (1-42), 5-TAMRA labeled - 0.1 mg

    5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

    520 MMP FRET Substrate 11 - 0.1 mg

    5-FAM-P-Cha-G-Nva-HA-Dap(QXL® 520)-NH2

    520 MMP FRET Substrate 12 - 0.1 mg

    5-FAM-RPKPYA-Nva-WM-K(QXL® 520)-NH2

    520 MMP FRET Substrate 13 - 0.1 mg

    5-FAM-RPKPVE-Nva-WRK(QXL® 520)-NH2

    520 MMP FRET Substrate 14 - 0.1 mg

    QXL® 520 -?-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)

    520 MMP FRET Substrate 15 - 0.1 mg

    QXL® 520 -?-Abu-PQGL-Dab(5-FAM)-AK-NH2

    520 MMP FRET Substrate 3 - 0.1 mg

    QXL® 520-PLGC(Me)HAr-K(5-FAM)-NH2
      1 - 20 of 131