Catalog

    1 - 20 of 166

    [Arg8]-Vasopressin (AVP) Peptide

    CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    ACTH (1-24), human

    SYSMEHFRWGKPVGKKRRPVKVYP

    ACTH (1-39), human

    SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

    ACTH (7-38), human - 1 mg

    FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

    Adrenomedullin (1-50), rat - 0.5 mg

    YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)

    Adrenomedullin (1-52), human - 0.5 mg

    YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
      1 - 20 of 166