Catalog

A huge collection of high purity peptides for different research areas such as Diabetes, Cardiovascular, Cell Permeable and Penetrating Peptides, etc.

    241 - 260 of 1092

    Beta-Amyloid (4-42) - 1 mg

    • FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
    • Cat.Number : AS-29908-1

    Charybdotoxin - 0.1 mg

    • Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
    • Cat.Number : AS-28244

    W Peptide, WKYMVm - NH2 - 1 mg

    • WKYMVm-NH2
    • Cat.Number : AS-27069

    490 MMP FRET Substrate X - 1 mg

    • DABCYL-RPLALWRS-EDANS
    • Cat.Number : AS-27104

    Endothelin 1, human, FAM-labeled - 0.5 mg

    • FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
    • Cat.Number : AS-27116

    390 MMP FRET Substrate 2 - 5 mg

    • Mca-PLGL-Dap(Dnp)-AR
    • Cat.Number : AS-27079

    PKCe Peptide Substrate - 1 mg

    • ERMRPRKRQGSVRRRV
    • Cat.Number : AS-27183

    390 MMP Substrate XIII, NFF-3 - 1 mg

    • Mca-RPKPVE-Nva-WR-K(Dnp)-NH2
    • Cat.Number : AS-27114

    Neurogranin 28-43 [AAKIQASFRGHMARKK], Biotin-LC - 5 mg

    • Biotin-LC-AAKIQASFRGHMARKK
    • Cat.Number : AS-27176

    390 MMP FRET Substrate XI - 5 mg

    • Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
    • Cat.Number : AS-27109
      241 - 260 of 1092