Catalog
A huge collection of high purity peptides for different research areas such as Diabetes, Cardiovascular, Cell Permeable and Penetrating Peptides, etc.
781 - 800 of 1093
Elafin - 0.1 mg
- AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
- Cat.Number : AS-61641
26Rfa, Hypothalamic Peptide, rat - 1 mg
- ASGPLGTLAEELSSYSRRKGGFSFRF-NH2
- Cat.Number : AS-61650
Histone H3 (1-21)-GGK(Biotin)-NH2 - 1 mg
- ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
- Cat.Number : AS-61702
781 - 800 of 1093