AS-62072 Trp Cage (EN)

Product and Company Identification Product Name: Trp Cage H - NLY IQW LKD GGP SSG RPP PS - OH Manufacturer/Supplier: AnaSpec, Inc. www.anaspec.com 34801...
Composition Ingredients/Components: Chemical Name: Trp Cage H - NLY IQW LKD GGP SSG RPP PS - OH Molecular formula: NA Molecular weight: 2169.5 CAS-No NA

AS-21687 TIP 39 Tuberoinfundibular Neuropeptide (EN)

Product and Company Identification Product Name: TIP 39, Tuberoinfundibular Neuropeptide H - SLA LAD DAA FRE RAR LLA ALE RRH WLN SYM HKL LVL DAP - OH Manufacturer...
Composition Ingredients/Components: Chemical Name: TIP 39, Tuberoinfundibular Neuropeptide H - SLA LAD DAA FRE RAR LLA ALE RRH WLN SYM HKL LVL DAP - OH

AS-61058 TRP 2 180 188 (EN)

Product and Company Identification Product Name: TRP - 2 (180 - 188) SVYDFFVWL Manufacturer/Supplier: AnaSpec, Inc. www.anaspec.com 34801 Campus Drive...
Composition Ingredients/Components: Chemical Name: TRP - 2 (180 - 188) SVYDFFVWL Molecular formula: N/A Molecular weight: 1175.4 CAS-No: N/A EC-No: N/A

AS-60877 Thrombospondin (TSP 1) Inhibitor LSKL (EN)

Product Data Sheet Product Name: LSKL, Inhibitor of Thrombospondin (TSP-1) Catalog Number: AS-60877 (1 mg) Lot Number: See label on vial Sequence: H-Leu-Ser-Lys-Leu-NH2...
Description: This peptide, derived from the latency-associated peptide, inhibits thrombospondin (TSP-1) activation of TGF- β; thus preventing the progression...
LSKL peptide (AnaSpec, San Jose, CA), a selective antagonist of TSP-1, and SLLK peptide (AnaSpec), an inert control, were used to evaluate effects of TSP

ID-WCRUB1-005 iD MOPS Running Buffer Powder

.: +1-510-791-9560 • Toll-free: +1 800-452-5530 • Fax: +1 510-791-9572 • service@anaspec.com • www.anaspec.com T echnic al Dat a Sheet iD MOPS Running...
Product Cat # Description Size ID-WCRUB1-005 iD MOPS Running Buffer Powder 5 packs for 5 x 1L running buffer Description iD MOPS Running Buffer Powder...
Using proprietary techniques, iD MOPS Running Buffer Powder is optimized to have a long shelf life, high resolution and fast electrophoresis.

AD-QCMMS-001 - MALDI-TOF MS - 1 QC

All modified and randomly selected unmodified Oligonucleotides are analyzed by MALDI-TOF Mass Spectrometry (Matrix Assisted Laser Desorption/ Ionization...
According to your application, your oligonucleotide purity can be checked by a supplemental Quality Control.- MALDI-TOF Mass Spectrometry analysis provides

ID WCRUB1 005 iD MOPS Running Buffer Powder (EN)

Identification of the substance/preparation and of the company/undertaking • Product name: iD MOPS Running Buffer Powder • Catalog number: ID-WCRUB1-005...
Composition/information on ingredients • Substance/preparation Substance • Dangerous Components Tris Base Formula: C H NO 4 11 3 MOPS Formula: C H NO S...
Hazards identification Tris Base MOPS SDS EDTA HMIS Rating Health 2 2 2 0 Flammability 0 0 1 0 Reactivity 0 0 0 0 NFPA Rating Health 2 2 2 0 Flammability

Tips for Choosing the Right SYBR® Master Mix

Understanding SYBR® qPCR Master Mix SYBR® qPCR Master Mix is a pre-mixed solution containing all the necessary components for performing qPCR, exce...

AS-60877 - Thrombospondin (TSP-1) Inhibitor, LSKL - 1 mg

AS-60877 AS-60877 This peptide, derived from the latency-associated peptide, inhibits thrombospondin (TSP-1) activation of TGF-ß, thus preventing the...
79-0 , C21H42N6O5 , 458.6 , SDS-EN-AS-60877-LSKL-Inhibitor-of-Thrombospondin.pdf , LSKL-NH2 , H-Leu-Ser-Lys-Leu-NH2 , TDS-EN-AS-60877-Thrombospondin-(TSP

AD-QCMHP-RP - MALDI-TOF MS RP-UHPLC - 1 QC

All modified and randomly selected unmodified Oligonucleotides are analyzed by MALDI-TOF Mass Spectrometry (Matrix Assisted Laser Desorption/ Ionization...
According to your application, your oligonucleotide purity can be checked by a supplemental Quality Control.- MALDI-TOF Mass Spectrometry analysis provides

AS-62072 - Exendin-4, C-terminal fragment (Trp Cage) - 1 mg

Trp Cage exhibits a highly stable mini-protein fold....
This stable fast-folding Trp Cage sequence displays special stabilizing features specific to this miniprotein....
, H-Asn-Leu-Tyr-Ile-Gln-Trp-Leu-Lys-Asp-Gly- , - 20 °C , Unconjugated , NA.26 , 2169.5 , Peak Area by HPLC ≥95%

AS-60875 - Thrombospondin (TSP-1) Inhibitor scrambled peptide, SLLK - 1 mg

AS-60875 AS-60875 A control peptide for LSKL (a thrombospondin-1 inhibitor peptide). Catalog Research use , Lyophilized , human , Cancer & Apop...

AS-21687 TIP 39 Tuberoinfundibular Neuropeptide Parathyroid Hormone 2 Receptor Agonist (EN)

- Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu- Leu-Val-Leu-Asp-Ala-Pro-OH (3-letter code) SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP...
Molecular Weight: 4505.3 Peptide Purity: >95% Appearance: Lyophilized white powder Peptide Reconstitution: Using H O, reconstitute by adding 50-60 µl to 1 mg TIP...
39 2 Storage: TIP 39 is shipped at ambient temperature.

Quantitation of amyloid beta peptides in CSF by surface enhanced MALDI-TOF

Quantitation of amyloid beta peptides in CSF by surface enhanced MALDI-TOF Methods Mol Biol 818 10.1007/978-1-61779-418-6_16 12-10-11 E.

Angiotensin II–Acetylcholine noncovalent complexes analyzed with MALDI–Ion mobility–TOF MS.

Angiotensin II–Acetylcholine noncovalent complexes analyzed with MALDI–Ion mobility–TOF MS. J Biomol Tech. 14(1) PMC2279889 01-03-03 AS.

AS-64811 - TRP-2, Tyrosinase-related Protein 2 (181-188) - 1 mg

, Tyrosinase , human, mouse , C58H73N9O12 , 1088.3 , SDS-EN-AS-64811-Tyrosinase-related-Protein-2-111-188.pdf , VYDFFVWL , H-Val-Tyr-Asp-Phe-Phe-Val-Trp-Leu-OH

AS-61058 - TRP-2, Tyrosinase-related Protein 2 (180-188) - 1 mg

Catalog Research use , Lyophilized , Cancer & Apoptosis , Oncogenesis , Tyrosinase , C61H78N10O14 , 1175.4 , SDS-EN-AS-61058-TRP-2-180-188.pdf , SVYDFFVWL...
, H-Ser-Val-Tyr-Asp-Phe-Phe-Val-Trp-Leu-OH , human, mouse , - 20 °C , Unconjugated , NA.26 , Peak Area by HPLC ≥95%

AS-65371 - Thrombospondin (TSP-1)-derived Peptide; binding motif for CD36 - 1 mg

AS-65371 AS-65371 This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. It ...

AS-21687 - TIP 39, Tuberoinfundibular Neuropeptide, Parathyroid Hormone 2 Receptor Agonist - 1 mg

Lyophilized , Cell Signaling , Hormones , Other Hormones , Calcium Metabolism , Parathyroid Hormone (PTH) , 277302-47-3 , C202H325N61O54S , SDS-EN-AS-21687-TIP...
Tuberoinfundibular-Neuropeptide.pdf , SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP , H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH...
, human, bovine , TDS-EN-AS-21687-TIP-39-Tuberoinfundibular-Neuropeptide-Parathyroid-Hormone-2-Receptor-Agonist.pdf , - 20 °C , Unconjugated , NA.26 ,

What can cause a SYBR® Green I reaction, which has been working well, stop working?

SYBR® Green I is unstable if diluted in a watery solution and also if it is not kept in the dark. Therefore Eurogentec offers kits that contain DMS...