Peptides

ADAMTS-13 FRET Substrate, FRETS-VWF73

303,00
Check your price
  • Cat.Number : AS-63728-01
  • Availability :
    In stock

Size

Quantity

FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.

Specifications

Chemistry
Sequence one letter code
  • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Sequence three letter code
  • H-Asp-Arg-Glu-Dap(Nma)-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-Dap(Dnp)-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH
Molecular Mass/ Weight
  • 8314.9
Properties
Absorbance (nm)
  • 340
Emission (nm)
  • 440
Modification
Conjugation type
  • Spacers
Modification Name
Conjugation
  • Conjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Application
Biomarker Target
Detection Method
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of S2238 peptide, Thrombin Substrate

Thrombin Substrate S2238 1 mg

Cat.Number : AS-63776
109,00