Catalog

A huge collection of high purity peptides for different research areas such as Diabetes, Cardiovascular, Cell Permeable and Penetrating Peptides, etc.

    1 - 20 of 122

    Angiotensin III - 5 mg

    • RVYIHPF
    • Cat.Number : AS-60704

    Apelin-36, human - 1 mg

    • LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
    • Cat.Number : AS-61095

    Fibrinopeptide B, human - 1 mg

    • Pyr-GVNDNEEGFFSAR
    • Cat.Number : AS-60697

    TRAP-5 (N-term), amide - 5 mg

    • SFLLR-NH2
    • Cat.Number : AS-60680

    Fibrinogen gamma-Chain (377-395) - 1 mg

    • YSMKETTMKIIPFNRLSIG
    • Cat.Number : AS-62128

    B-type Natriuretic Peptide, BNP-45 (51-95), rat - 0.5 mg

    • SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23-39)
    • Cat.Number : AS-61153

    B-type Natriuretic Peptide, BNP-45, mouse - 0.5 mg

    • SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL (Disulfide bridge:23-39)
    • Cat.Number : AS-61152

    Angiotensin (1-7) - 1 mg

    • DRVYIHP
    • Cat.Number : AS-61039
      1 - 20 of 122