Peptides

Adrenomedullin (1-50), rat - 0.5 mg

334.00
Check your price
  • Cat.Number : AS-60454
  • Availability :
    In stock

Select specification

Quantity

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.

Specifications

Chemistry
Sequence one letter code
  • YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
Sequence three letter code
  • H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: 14-19)
CAS registry number
  • 159964-38-2
Molecular Formula
  • C242H381N77O75S5
Molecular Mass/ Weight
  • 5729.5
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • rat
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of HOE I40 peptide

Bradykinin Antagonist, HOE I40 - 1 mg

Cat.Number : AS-22968
110.00 Excl. Tax
Image of a kit SensoLyte 390 ACE2 Activity Assay Kit Fluorimetric

SensoLyte® 390 ACE2 Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72086
465.00 Excl. Tax
Image of a kit SensoLyte 520 ECEs Activity Assay Kit Fluorimetric

SensoLyte® 520 ECEs Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72243
509.00 Excl. Tax