Peptides

Adrenomedullin (1-52), human - 0.5 mg

309,00
Check your price
  • Cat.Number : AS-60447
  • Availability :
    In stock

Select specification

Quantity

Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name 'Adrenomedullin.' Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.

Specifications

Chemistry
Sequence one letter code
  • YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
Sequence three letter code
  • H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: 16-21)
CAS registry number
  • 148498-78-6
Molecular Formula
  • C264H406N80O77S3
Molecular Mass/ Weight
  • 6028.8
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human

You may also be interested in the following product(s)

Citations

Pathogenesis of Pancreatic Cancer Exosome-Induced Lipolysis in Adipose Tissue.

Gut . 2015 Apr 28 ; 65(7) 1165 | DOI : 10.1136/gutjnl-2014-308350

  • G. Sagar
  • et al