Peptides

B-type Natriuretic Peptide, BNP-32, human

240.00
Check your price
  • Cat.Number : AS-24015
  • Availability :
    In stock

Size

Quantity

B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S). This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations.
BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to oppose the renin-angiotensin-aldosterone system and exert vasodilatory effects. This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides.

Specifications

Chemistry
Sequence one letter code
  • SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
Sequence three letter code
  • H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide bridge: 10-26)
CAS registry number
  • 114471-18-0
Molecular Formula
  • C143H244N50O42S4
Molecular Mass/ Weight
  • 3464.2
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
Storage & stability
Form
  • Lyophilized
Storage Conditions
  • - 20 °C
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of ANP(1-28) peptide, human peptide, porcine

Atrial Natriuretic Peptide (1-28), human, porcine

Cat.Number : AS-20647
122.00 Excl. Tax
Tube of CNP peptide, human,porcine

C-Type Natriuretic Peptide (32-53), human, porcine - 1 mg

Cat.Number : AS-24244
219.00 Excl. Tax
Image of a kit SensoLyte 390 ACE2 Activity Assay Kit Fluorimetric

SensoLyte® 390 ACE2 Activity Assay Kit Fluorimetric - 1 kit

Cat.Number : AS-72086
465.00 Excl. Tax