Peptide Enzyme Substrates

    21 - 40 of 115

    580 MMP FRET Substrate 8 - 0.1 mg

    • QXL® 570-KPLA-Nva-Dap(5-TAMRA)-AR-NH2
    • Cat.Number : AS-60585-01

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    ADAMTS-4/Aggrecanase FRET Substrate, WAAG-3R - 1 mg

    • Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
    • Cat.Number : AS-60431-1

    Bacterial Sortase Substrate I, FRET - 1 mg

    • DABCYL-LPETG-EDANS
    • Cat.Number : AS-62231

    CDK1 Substrate [HATPPKKKRK] - 5 mg

    • HATPPKKKRK
    • Cat.Number : AS-60522-5

    CDK5 Substrate [PKTPKKAKKL] - 1 mg

    • PKTPKKAKKL
    • Cat.Number : AS-60026-1
      21 - 40 of 115