Blue (<500 nm)

    1 - 20 of 26

    490 MMP Substrate 16 (TNO211) - 1 mg

    • DABCYL-(γ-Abu)-PQGL-E(EDANS)AK-NH2

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
      1 - 20 of 26