FRET Substrates

    1 - 19 of 19

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
      1 - 19 of 19