Peptides
We offer custom and catalog peptides with 95% % purity by HPLC unless otherwise specified. For your more demanding project, we produce GMP grade peptides.
1 - 20 of 197
HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg
- ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
- Cat.Number : AS-60743
hBD-1, b-Defensin-1, human - 0.1 mg
- DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34, 12-27, 17-35)
- Cat.Number : AS-60740
HNP-2, a-Defensin-2, Human Neutrophil Peptide-2 - 0.1 mg
- CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
- Cat.Number : AS-60744
HEL (46-61), Lysozyme C (46-61) (chicken) - 1 mg
- NTDGSTDYGILQINSR
- Cat.Number : AS-60504-1
1 - 20 of 197