Peptides

We offer custom and catalog peptides with 95% % purity by HPLC unless otherwise specified. For your more demanding project, we produce GMP grade peptides.

    21 - 40 of 1100

    Gastrin-1, human - 1 mg

    • Pyr-GPWLEEEEEAYGWMDF-NH2
    • Cat.Number : AS-20750

    Parathyroid Hormone (1-34), human, biotinylated - 1 mg

    • Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
    • Cat.Number : AS-20690

    Syntide-2 [PLARTLSVAGLPGKK] - 5 mg

    • PLARTLSVAGLPGKK
    • Cat.Number : AS-22552

    Amylin (8-37), rat, mouse - 1 mg

    • ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
    • Cat.Number : AS-21749

    VSV-G Peptide - 1 mg

    • YTDIEMNRLGK
    • Cat.Number : AS-21152

    Beta-Amyloid (22-35) - 1 mg

    • EDVGSNKGAIIGLM
    • Cat.Number : AS-22823

    Gastrin-1, rat - 1 mg

    • Pyr-RPPMEEEEEAYGWMDF-NH2
    • Cat.Number : AS-20752

    Bradykinin Antagonist, HOE I40 - 1 mg

    • rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
    • Cat.Number : AS-22968

    Biotin-beta-Amyloid (17-40) - 1 mg

    • Biotin-LVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23541

    [Lys3]-Bombesin - 5 mg

    • Pyr-QKLGNQWAVGHLM-NH2
    • Cat.Number : AS-22838

    Beta-Amyloid (25-35) • HCl - 5 mg

    • GSNKGAIIGLM • HCl
    • Cat.Number : AS-23212

    Big Endothelin-1 (1-39), porcine - 1 mg

    • CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
    • Cat.Number : AS-20715

    Fibrinopeptide A, human - 1 mg

    • ADSGEGDFLAEGGGVR
    • Cat.Number : AS-20735

    Neurotensin (8-13) - 5 mg

    • RRPYIL
    • Cat.Number : AS-22964

    PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat - 0.5 mg

    • HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
    • Cat.Number : AS-23648
      21 - 40 of 1100