Catalog

    1 - 20 of 111

    [Arg8]-Vasopressin (AVP) Peptide

    CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR

    Adrenomedullin (1-50), rat - 0.5 mg

    YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)

    Adrenomedullin (1-52), human - 0.5 mg

    YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)

    Angiotensin I, human, ClearPoint™ Val Ile labeled (13C and 15N) - 0.1 mg

    DR-V*-Y-I*-HPFHL [Val* = Val(U-13C5,15N); Ile* = Ile(U-13C6,15N)]
      1 - 20 of 111