Catalog

    1 - 20 of 30

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
      1 - 20 of 30