Products

Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.

    1 - 20 of 53

    NGR Peptide 1 - 1 mg

    • CNGRCGGklaklakklaklak-NH2 (Disulfide bridge: 1-5)
    • Cat.Number : AS-60189-1

    Aminopeptidase N Ligand (CD13), NGR peptide - 5 mg

    • CNGRCG (Disulfide bridge: 1-5)
    • Cat.Number : AS-60171-5

    Transdermal Peptide - 1 mg

    • ACSSSPSKHCG
    • Cat.Number : AS-62066

    TAT-NSF222scr Fusion Polypeptide, scrambled - 1 mg

    • YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
    • Cat.Number : AS-62210

    TAT-NSF222 Fusion Peptide - 1 mg

    • YGRKKRRQRRR-GGG-LDKEFNSIFRRAFASRVFPPE
    • Cat.Number : AS-62240

    TAT-NSF700scr - 1 mg

    • YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
    • Cat.Number : AS-62209

    Tat-C (48-57) - 1 mg

    • CGRKKRRQRRR
    • Cat.Number : AS-62063

    Tat-NR2Bct - 1 mg

    • YGRKKRRQRRRKLSSIESDV
    • Cat.Number : AS-62042

    TAT-NSF700 Fusion Peptide - 1 mg

    • YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
    • Cat.Number : AS-62238

    Cys(Npys)-TAT (47-57), FAM-labeled - 1 mg

    • C(Npys)YGRKKRRQRRR-K(FAM)-NH2
    • Cat.Number : AS-61213

    Cys(Npys)-(D-Arg)9 - 1 mg

    • C(Npys)RRRRRRRRR-NH2
    • Cat.Number : AS-61206

    Cys(Npys)-(Arg)9 - 1 mg

    • C(Npys)RRRRRRRRR-NH2
    • Cat.Number : AS-61205

    TAT (47-57), FAM-labeled - 1 mg

    • FAM-YGRKKRRQRRR
    • Cat.Number : AS-61210

    (Arg)9, FAM-labeled - 1 mg

    • FAM-RRRRRRRRR
    • Cat.Number : AS-61207

    (Arg)9, TAMRA-labeled - 1 mg

    • TAMRA-RRRRRRRRR
    • Cat.Number : AS-61208

    Transportan - 1 mg

    • GWTLNSAGYLLGKINLKALAALAKKIL
    • Cat.Number : AS-61256

    Buforin 2 - 1 mg

    • TRSSRAGLQFPVGRVHRLLRK
    • Cat.Number : AS-61255

    Cys(Npys) Antennapedia Peptide, amide - 1 mg

    • C(Npys)-RQIKIWFQNRRMKWKK-NH2
    • Cat.Number : AS-61034

    Antennapedia Peptide, acid - 1 mg

    • RQIKIWFQNRRMKWKK
    • Cat.Number : AS-61032
      1 - 20 of 53