You are here:

Home
Our catalog
Products

Products

Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.

Filters

Products

Format

2X Master Mix (13)

4X Master Mix (2)

5X Master Mix (6)

Core Kit (4)

High profile (6)

Low profile (9)

Non-skirted (4)

Semi-skirted (1)

Skirted (2)

Sub-skirted (4)

Color

Blue (35)

Blue fluorescence (8)

Clear (25)

clear glass grade (3)

Frosted (5)

Green (53)

Green Fluorescence (25)

InfraRed (14)

Natural (1)

Orange (57)

Orange fluorescence (16)

Pink (2)

Red (37)

Red fluorescence (25)

White (10)

Yellow (7)

Yellow Fluorescence (12)

Modification name

Abz-DNP (4)

AFC (11)

Alexa Fluor® 488 (4)

Alexa Fluor® 647 (4)

AMC (6)

AP5 (1)

Biotin (170)

Biotin TEG (1)

Cy®3 (4)

Cy®5 (5)

Cy®5-QXL®670 (2)

Dnp (1)

Dragonfly orange (1)

DY 632 (3)

EDANS-DABCYL (10)

FAM (45)

FAM-QXL® 520 (17)

FITC (10)

HEX (1)

HiLexa Fluor™ 488 (1)

HiLyte™ Fluor 488 (10)

HiLyte™ Fluor 488-QXL® 520 (3)

HiLyte™ Fluor 555 (4)

HiLyte™ Fluor 647 (6)

HiLyte™ Fluor 750 (2)

JOE (1)

MCA-Dnp (8)

Phosphate (1)

PNA (6)

Rhodamine110 (5)

ROX™ (6)

TAMRA (17)

TAMRA-QXL® 570 (1)

TET (1)

Yakima Yellow® (1)

Yakima Yellow®-BHQ-1® (2)

Yakima Yellow®-TAMRA (2)

qPCR compatible thermocyclers

ABI - Prism® SDS 5700 (14)

ABI - Prism® SDS 7000 (14)

ABI - Prism® SDS 7300 (14)

ABI - Prism® SDS 7500 (13)

ABI - Prism® SDS 7500 FAST (7)

ABI - Prism® SDS 7700 (14)

ABI - Prism® SDS 7900/7900 HT (14)

ABI - Prism® SDS 7900/7900 HT FAST (7)

ABI - StepOnePlus™ (12)

ABI - StepOne™ (14)

ABI- ViiA7™ (12)

ABI- ViiA7™ FAST (6)

Analytik jena - qTower (14)

Analytik jena - qTOWER³ (14)

Analytik jena - qTOWERiris (14)

Bio Molecular Systems - Mic (10)

BioRad - CFX Duet (14)

BioRad - CFX384® (12)

BioRad - CFX96® (14)

BioRad - DNA Engine Opticon™ 1 (14)

BioRad - DNA Engine Opticon™ 2 (14)

BioRad - iCycler™ (16)

BioRad - iQ™ (8)

BioRad - iQ™5 (10)

BioRad - MiniOpticon® (7)

BioRad - My iQ™ (17)

BioRad- Chromo 4™ (14)

Cepheid - Smartcycler™ 1 (10)

Cepheid - Smartcycler™ 2 (10)

Eppendorf - MasterCycler® ep realplex (13)

Esco - Swift™ Spectrum 96 (12)

Life technologies - QuantStudio™ (13)

Life technologies - QuantStudio™ FAST (7)

PCRmax - Eco 48 (10)

Qiagen - QIAquant 384 (11)

Qiagen - QIAquant 96 (14)

Qiagen/Corbett - Rotor-Gene™ 2000 (10)

Qiagen/Corbett - Rotor-Gene™ 3000 (10)

Qiagen/Corbett - Rotor-Gene™ 6000 (10)

Qiagen/Corbett - Rotor-Gene™ Q (10)

Roche - LightCycler® 480 (16)

Roche - LightCycler® 96 (13)

Roche - LightCycler® Nano (12)

Roche - LightCycler® PRO (10)

Roche COBAS z 480 (6)

Stratagene/Agilent - AriaMX (16)

Stratagene/Agilent - Mx3000P™ (13)

Stratagene/Agilent - Mx3000P™ (without ROX normalisation) (14)

Stratagene/Agilent - Mx3005P™ (13)

Stratagene/Agilent - Mx3005P™ (without ROX normalisation) (14)

Stratagene/Agilent - Mx4000™ (13)

Stratagene/Agilent - Mx4000™ (without ROX normalisation) (14)

Techne - Quantica™ (14)

Thermo Scientific - PikoReal® (10)

Application

Aggregation/Fibrillation (16)

Analyte quantitation (16)

Antigen uptake assay (3)

Binding assays (2)

Carrier protein (1)

Cell staining (86)

DNA Electrophoresis (1)

Dot blot (1)

Drug delivery studies (7)

Electroporation quantitation (4)

ELISA (41)

ELISA + FRET (4)

Enzyme activity (129)

Flow Cytometry (54)

Fluorescence in situ hybridization (FISH) (9)

Fluorimetric (24)

FRET (207)

Immune complex recycling assays (1)

Immunocytochemistry (ICC) (1)

Immunofluorescence (IF) (56)

Immunohistochemistry (IHC) (23)

Immunoprecipitation (IP) (15)

in vitro studies (5)

in vivo studies (10)

IVD (in vitro Diagnostics) (2)

Labeling (75)

Lymphatic circulation tracking (3)

Mass Spectrometry (11)

Microvascular imaging (4)

Nucleic acid detection (2)

Permeability assays (1)

Pre-Clinical animal studies (Not to be used as an API in it's current form) (2)

Protease activity (194)

Protein analysis standard (1)

Protein printing (1)

QC Controls & Standards (2)

qPCR (1)

Quantitation assays (2)

Receptor binding studies (38)

Receptor-mediated endocytosis/exocytosis (4)

RT-qPCR (1)

Screening (49)

T-cell epitope (5)

TR-FRET (7)

Western Blotting (40)

Zymography (6)

Biomarker Target

(Arg)9 (6)

3CLPro (2)

Abl Kinase (2)

Acetylcholinesterase (1)

ADAM10 (1)

ADAMTS-13 (2)

ADAMTS-4 (Aggrecanase) (2)

Adeno-Associated Virus (1)

Adrenocorticotropic Hormone (ACTH) (7)

Adrenomedullin (4)

Adropin (1)

AKT Kinase (PKB) (3)

Allophycocyanin (2)

alpha-Mating Factor (1)

Alpha-Secretase (TACE) (1)

AMPK Kinase (3)

Amylin/Islet Amyloid Polypeptide (IAPP) (8)

Angiotensin (15)

Antennapedia peptide (4)

Anti-BetaGamma (1)

Apamin (1)

Apelin (5)

Apidaecin (1)

Aquaporin (1)

Bactenecin (2)

Bacterial signal peptidase (1)

BAD (3)

BAK (2)

Basic Fibroblast Growth Factor (bFGF) (1)

BAX (2)

Bcl2 (1)

BDC2.5 mimotope (2)

Beclin (2)

Beta-actin (1)

beta-amyloid (143)

beta-amyloid (1-28) (6)

beta-amyloid (1-40) (35)

beta-amyloid (1-42) (36)

beta-amyloid (X-40) (8)

beta-amyloid (X-42) (12)

Beta-Amyloid Bri (2)

Beta-Amyloid fragment (38)

Beta-Casomorphin (1)

Beta-Galactosidase (5)

Beta-Secretase (3)

BID (3)

BIM (2)

Biotin (14)

Bombesin (3)

Bone Morphogenetic Protein (BMP-2) (1)

Bradykinin (10)

BSA (5)

Buforin 2 (1)

C3a (2)

C5a (2)

Cadherin (1)

Caerulin (1)

Calcein (5)

Calcitonin (2)

Calcitonin Gene Related Peptide (CGRP) (5)

Caloxin (3)

Calpain (5)

CaM Kinase (5)

Casein kinase (2)

Caspase (16)

Caspase 1 (4)

Caspase 3 (8)

Caspase 7 (3)

Caspase 8 (2)

Caspase 9 (2)

Cathelicidin (2)

Cathepsin (12)

Cathepsin B (3)

Cathepsin D (3)

Cathepsin E (2)

Cathepsin G (1)

Cathepsin K (2)

Cathepsin L (2)

Cathepsin S (2)

Cdk-1 (human) (1)

Cecropin (2)

CFP10 (1)

Charybdotoxin (1)

Chemerin (1)

Chlorotoxin (Cltx) (1)

Cholecystokinin (CCK) (4)

CKS-17 (1)

Clk Kinase (1)

C-Myc (1)

Colivelin (1)

Collagen (1)

Competence stimultating peptide (2)

Complement factor (6)

Conantokin G (1)

Corticotropin-Releasing Factor (CRF) (3)

C-Peptide (6)

CRAMP (2)

Cyclin-dependent kinase (3)

Cytochrome C (2)

Cytochrome P-450 (2)

Cytomegalovirus (CMV) (6)

Defensin (5)

delta-toxin (1)

Deltorphin (2)

Dermcidin (1)

Deubiquitination (1)

Dipeptidylaminopeptidase (DPPIV) (4)

DNA-dependent Protein Kinase (DNA-PK) (1)

Drosocin (1)

DYKDDDDK tag (1)

Dynorphin (3)

DYRK Kinase (2)

Eg-5 (human) (1)

EGFR (4)

EGFR Kinase (1)

Elafin (1)

Elastase (5)

Endorphin (1)

Endothelin (6)

Endothelin Converting Enzyme (ECE) (1)

Enkephalin (2)

Enterokinase (3)

Enterotoxin (1)

Epstein-Barr Virus (EBV) (8)

Erythropoietin-Mimetic Peptide 17 (EMP17) (2)

Exendin (8)

Factor Xa (2)

FAP/Seprase (1)

Fibrinogen (4)

Fibrinopeptide (3)

Fibronectin (1)

Flagellin (1)

Furin (3)

GAD65 (2)

GALA (1)

Galactosaminidase (1)

Galanin (1)

gamma D-glutamic acid (DPGA) (2)

Gap junction (5)

Gastric Inhibitory Polypeptide (GIP) (5)

Gastrin (5)

Gastrin Releasing Peptide (1)

GFP (2)

Ghrelin (5)

Gliadin (2)

Glucagon (5)

Glucagon-Like Peptide 1 (GLP-1) (10)

Glucocerebrosidase (2)

GluGlu tag (1)

Glutamate Receptor (1)

Glutaminyl cyclase (1)

Glutathione (3)

gp100 (3)

Granzyme A (1)

Granzyme B (1)

Growth Hormone Releasing Factor (GRF, GHRH) (1)

GSH (3)

GSK3 Kinase (1)

GST (1)

HA tag (3)

Hepatitis C Virus (HCV) (7)

Herpes Simplex Virus (HSV) (1)

Hirudin (1)

His tag (1)

Histatin (1)

Histone (150)

Histone acetyltransferase (HAT) (1)

Histone deacetylase (HDAC) (2)

Histone H1 (2)

Histone H2 (4)

Histone H3 (1-21) (41)

Histone H3 (21-44) (17)

Histone H3 Fragment (44)

Histone H4 (1-21) (12)

Histone H4 (1-23) (9)

Histone H4 Fragment (21)

HMGN2 (1)

Human Immunodeficiency Virus 1 (HIV1) (10)

Human Papillomavirus (HPV) (1)

Humanin (4)

HY (2)

Hyaluronan (2)

Hydrogen Peroxide (1)

Hypoxia-Inducible Factor-1 (HIF-1 α) (1)

IGRP (1)

Indolicidin (2)

Influenza Virus (16)

Insulin (4)

Insulin Degrading Enzyme (IDE) (1)

Insulin Receptor Kinase (3)

Integrin (1)

Interleukin (1)

Interphotoreceptor Retinoid Binding Protein (IRBP) (3)

IRAK Kinase (1)

JAG-1 (2)

JAK Kinase (1)

KALA (1)

Kallidin (3)

Kallikrein (8)

Keratin (1)

Kinase (2)

Kisspeptin (2)

Lactoferrin (1)

Lactotransferrin (1)

LaminB1 (human) (1)

Laminin (2)

Leptin (1)

LIM Kinase (1)

LL-37 (9)

LLO (2)

Luciferase (2)

Luteinizing Hormone-Releasing Hormone (LH-RH) (1)

Lymphocytic Choriomeningitis Virus (LCMV) (6)

LyP-1 (1)

Lysozyme (1)

Magainin (2)

MAGE (1)

MAP Kinase (5)

MAP peptide (1)

Mastoparan (1)

Matriptase (1)

Matrix Metalloproteinase (MMP) (63)

Melan-A (3)

Melanocyte Stimulating hormone (MSH) (1)

Melittin (1)

Meprin (2)

Methylcytosine (1)

MHC (1)

MMP-1 (7)

MMP-10 (2)

MMP-12 (4)

MMP-13 (4)

MMP-14 (2)

MMP-2 (5)

MMP-3 (3)

MMP-7 (2)

MMP-8 (3)

MMP-9 (5)

MOTS (1)

Mucin (7)

Murine leukemia virus (MuLV) (1)

Myelin Basic Protein (MBP) (7)

Myelin Oligodendrocyte Glycoprotein (MOG) (13)

Myelin Proteolipid Protein (PLP) (6)

Myeloid Antimicrobial Peptide (4)

Myosin (1)

Myosin Light Chain Kinase (MLCK) (3)

NADP/NADPH (6)

Natriuretic Peptide (8)

NEMO (1)

Neprilysin (1)

Nesfatin (2)

Neurogranin (5)

Neuropeptide S (2)

Neuropeptide Y (2)

Neurotensin (3)

NFkB (2)

NG2 (2)

NGR (2)

NOXA (1)

Nuclear Factor (Nrf2) (1)

NuMA (human) (1)

NY-ESO-1 (1)

OGlcNac (1)

Orexin (3)

Osteocalcin (2)

OVA (20)

Oxytocin (2)

p53 (6)

p60 c-Src Kinase (5)

Pancreastatin (2)

Pancreatic Polypeptide (1)

Pannexin (1)

Papain-like Protease (1)

Parathyroid Hormone (PTH) (5)

PDK Kinase (1)

PD-L1 (5)

Penetratin (2)

Pep-1 (2)

Peptide YY (2)

Peptidyl-prolyl isomerase (Pin1) (1)

Peripheral Myelin Protein (2)

Peroxidase (6)

Pertussis toxin (1)

pGL2 luciferase (firefly) (1)

pGL3 luciferase (firefly) (1)

Phosphatase (7)

Phosphate (1)

Phycocyanin (1)

Phycoerythrin (4)

Phytochelatin (5)

PI3K Kinase (1)

PI3K/AKT/mTOR (1)

Pituitary adenylate cyclase-activating polypeptide (PACAP) (5)

PKA Kinase (5)

Plasmepsin (2)

Plasmin (3)

Plasminogen activator (3)

Plasmodium (1)

Platelet Factor (1)

Pleurocidin (1)

PMDM6 (1)

Preptin (1)

Prion Protein (PrP) (1)

Proapoptotic Peptide (2)

pro-NPY (1)

Prosaptide (1)

Protease (3)

Protease-Activated Receptor (PAR) (18)

Protegrin (1)

Protein (1)

Protein A (6)

Protein Kinase C (11)

Protein Kinase G (1)

PUMA (1)

Pyrrhocoricin (1)

Rabies Virus Glycoprotein (RVG) (2)

Renin (13)

RF-Amide (2)

RGD peptide (22)

Rhodopsin tag (1)

Ryanodine Receptor (RYR) (2)

S6 Kinase (3)

SARS CoV 2 (1)

SARS CoV 2-O-methyltransferase (5)

Sauvagine (1)

Secretin (1)

Secretoneurin (1)

Serine/Threonine Kinase 11 (1)

Shepherdin (1)

Sirtuin (SIRT) (6)

Smac/Diablo (1)

Small Humanin-Like Peptide (SHLP) (4)

SMAP (1)

Somatostatin (2)

Sortase A (5)

Spexin (3)

Spike protein (32)

Src Kinase (1)

Steroid Receptor Coactivator-1 (SRC-1) (3)

Streptavidin (13)

Substance P (3)

SV40 (2)

Syk kinase (2)

Synuclein (9)

TAT (HIV transactivator protein) (20)

Tau (10)

Temporin (2)

Tetanus toxin (2)

Thioflavin T (3)

Thiol (3)

Thrombin (4)

Thrombospondin (3)

TNF alpha (1)

Tobacco Etch Virus (TEV) (1)

Transcriptional Intermediary Factor (TIF) (1)

Transdermal peptide (1)

Transferrin R (1)

Transglutaminase (1)

Transportan (1)

Trypsin (1)

Tubulin (1)

Tyrosinase (3)

Tyrosine Kinase (3)

Tyrosine Phosphatase 1B (2)

Uroguanylin (1)

V5 tag (1)

Vaccinia virus (1)

Vascular Endothelial Growth Factor (VEGF) (1)

Vasoactive Intestinal Peptide (VIP) (3)

Vasopressin (1)

Vesicular Stomatitis Virus (VSV) (1)

VHH (sdAbs) (1)

Vimentin (human) (1)

Vitronectin (1)

W peptide (2)

West Nile Virus (WNV) (3)

Xenin (1)

ω-Conotoxin (1)

Detection Method

Colorimetric (33)

Fluorescent (462)

Luminescent (3)

Probe (51)

SYBR (5)

Clonality

Monoclonal (1)

Polyclonal (1)

Research Area

Adhesion & Extracellular Matrix (97)

Cancer & Apoptosis (183)

Cardiovascular Research (142)

Cell & Tissue Biology (39)

Cell Permeable & Penetrating peptides (53)

Cell Signaling (439)

Diabetes (69)

Epigenetics (161)

Hormones (103)

Immunology and Infectious disease (220)

Neuroscience (272)

Peptide & Protein Analysis (323)

Sub-category Research Area

Alzheimer's Disease (183)

Angiogenesis (6)

Antennapedia peptides (6)

Apoptosis & Cell Death (46)

Arginine Oligomers (6)

Autophagy (2)

Calcium Metabolism (16)

Cancer Immuno modulators (2)

Cancer Targeting (3)

Cell adhesion proteins (12)

Cell proliferation & Cytotoxicity (6)

Coagulation (41)

Creutzfeldt-Jakob Disease (1)

Enzyme Substrates & Inhibitors (105)

Epigenetics-related Enzymes (11)

Fluorescence reference standards (2)

Gap Junctions (5)

Gastrointestinal Tract (43)

Glucagon (4)

GPCR (167)

Hematology (2)

Histone Peptides (150)

HIV Tat Fragments (21)

Hypothalamo-Pituitary (HPA) Axis (26)

Immunology (54)

Incretins & related Hormones (23)

Inflammation (10)

Insulin/Amylin (19)

Ion Channel Modulators (15)

Kinases, Substrates & Inhibitors (76)

Labeling Reagents (152)

Mass Spectrometry standards (5)

Mastoparan (1)

Membrane Potential (10)

Metabolism (13)

Metal Chelation (5)

Microbiology/Bacteriology (64)

Mitochondrial Biology (5)

Multiple Antigenic Peptide (MAP) (1)

Multiple Sclerosis (28)

Neuropeptides (41)

Oncogenesis (128)

Opioids (9)

Other CPP Peptides (17)

Other Diabetes-related Molecules (18)

Other Hormones (9)

Other Neuroscience Effectors (5)

Oxidative Stress (14)

Pancreas (23)

Parkinson's Disease (12)

Pep-1 (2)

Peptide Libraries (9)

Protein Assay Kits (123)

Protein Labeling Kits (22)

Renin/Angiotensin (RAS) Cascade (48)

RGD Peptides (22)

Signal Transduction (17)

Tags (13)

Tissue Remodeling/MMPs (63)

Vasoconstriction/Vasodilation (45)

Virology (100)

Host

CHO (mammalian cells) (8)

E coli & Sf 21 (baculovirus)-derived (1)

E. coli (53)

Escherichia coli (5)

HEK293 (mammalian cells) (8)

High 5 cells (baculovirus)-derived (2)

Mouse (1)

Native (2)

NS0 (1)

NSO (mammalian cells) (7)

Rabbit (1)

Sf 21 (baculovirus)-derived (5)

581 - 600 of 2051

Ghrelin, rat, mouse Peptide

GS-S(n-octanoyl)-FLSPEHQKAQQRKESKKPPAKLQPR
Cat.Number : AS-24160

Quick view

PACAP (6-38), amide, human, ovine, rat

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Cat.Number : AS-22516

Quick view

H2-DCFDA [2',7'-Dichlorodihydrofluorescein diacetate] - 100 mg

Cat.Number : AS-85706

Quick view

MQAE [N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide] - 100 mg

Cat.Number : AS-84925

Quick view

5' HRP Conjugation 2.5 µmol scale - 1 modification

Cat.Number : MD-CN092-05M02

Quick view

NGS DNA Base HPLC purification - 10 nmol

Cat.Number : BA-NGSHP-001

Quick view

NGS DNA Base Phosphorothioate Link HPLC purification - 10 nmol

Cat.Number : BA-NGSHP-PT-001

Quick view

5' SBP Conjugation 2.5 µmol scale - 1 modification

Cat.Number : MD-CN096-05M02

Quick view

NGS 5' Phosphate - 10 nmol

Cat.Number : MD-PH002-05001

Quick view

Dihydroethidium [Hydroethidine] - 25 mg

Cat.Number : AS-85704

Quick view

Gel Maker set for Mupid®-ONE - 2 ST, 1 LT, 4 combs, 1 stand p

Cat.Number : MU-0041-MS

Quick view

Pluronic® F-127, 10 % solution in water - 100 ml

Cat.Number : AS-84042

Quick view

Thioflavin T UltraPure Grade - 1 g

Cat.Number : AS-88306

Quick view

Dihydrorhodamine 123 - 10 mg

Cat.Number : AS-85711

Quick view

Calcein; AM UltraPure Grade Small Package - 20 x 50 µg

Cat.Number : AS-89204

Quick view

Standard comb for Mupid®-ONE - 2 PCE

Cat.Number : MU-0041-SC

Quick view

5' Peptide Conjugation 2.5 µmol scale - 1 modification

Cat.Number : MD-CN099-05M02

Quick view

HiLyte™ Fluor 532 succinimidyl ester (SE) - 1 mg

Cat.Number : AS-89341

Quick view

HiLyte™ Fluor 532 hydrazide - 1 mg

Cat.Number : AS-89343

Quick view

HiLyte™ Fluor 532 C2 maleimide - 1 mg

Cat.Number : AS-89342

Quick view

581 - 600 of 2051

New IP-free ATTO dyes

Takyon^® qPCR sample

Smart Ladder

Large scale antibody production

GMP peptide

Assay Kits

Request a quote

Experience

Quality

Facilities

Products

Ghrelin, rat, mouse Peptide

PACAP (6-38), amide, human, ovine, rat

H2-DCFDA [2',7'-Dichlorodihydrofluorescein diacetate] - 100 mg

MQAE [N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide] - 100 mg

5' HRP Conjugation 2.5 µmol scale - 1 modification

NGS DNA Base HPLC purification - 10 nmol

NGS DNA Base Phosphorothioate Link HPLC purification - 10 nmol

5' SBP Conjugation 2.5 µmol scale - 1 modification

NGS 5' Phosphate - 10 nmol

Dihydroethidium [Hydroethidine] - 25 mg

Gel Maker set for Mupid®-ONE - 2 ST, 1 LT, 4 combs, 1 stand p

Pluronic® F-127, 10 % solution in water - 100 ml

Thioflavin T UltraPure Grade - 1 g

Dihydrorhodamine 123 - 10 mg

Calcein; AM UltraPure Grade Small Package - 20 x 50 µg

Standard comb for Mupid®-ONE - 2 PCE

5' Peptide Conjugation 2.5 µmol scale - 1 modification

HiLyte™ Fluor 532 succinimidyl ester (SE) - 1 mg

HiLyte™ Fluor 532 hydrazide - 1 mg

HiLyte™ Fluor 532 C2 maleimide - 1 mg

Products

GMP Services

Company

Support

Order

Legal

New IP-free ATTO dyes

Takyon® qPCR sample

Smart Ladder

Large scale antibody production

GMP peptide

Assay Kits

Request a quote

Experience

Quality

Facilities

Products

Takyon^® qPCR sample