Peptides

Cardiac Ryanodine Receptor RYR2 (2460-2495) - 1 mg

282,00
Check your price
  • Cat.Number : AS-64769
  • Availability :
    In stock

Quantity

This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.

Specifications

Chemistry
Sequence one letter code
  • GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Sequence three letter code
  • H-Gly-Phe-Cys-Pro-Asp-His-Lys-Ala-Ala-Met-Val-Leu-Phe-Leu-Asp-Arg-Val-Tyr-Gly-Ile-Glu-Val-Gln-Asp-Phe-Leu-Leu-His-Leu-Leu-Glu-Val-Gly-Phe-Leu-Pro-OH
Molecular Formula
  • C194H293N45O49S2
Molecular Mass/ Weight
  • 4104.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human, rat, rabbit, mouse
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)