Peptides

VIP, human, porcine, rat

68,00
Check your price
  • Cat.Number : AS-22872
  • Availability :
    In stock

Select specification

Size

Quantity

The 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator. VIP is broadly distributed in the peripheral and central nervous systems. It has an amino acid sequence identity of 68% with pituitary adenylate cyclase-activating polypeptide (PACAP). VIP and PACAP inhibit TNF-a, IL-1ß, IL-6, and NO production by lipopolysaccharide (LPS)-activated microglia. Both regulate the production of proinflammatory factors at a transcriptional level by inhibiting p65 nuclear translocation and nuclear factor-kB-DNA binding. As well, VIP relaxes the smooth muscle of the respiratory, gastrointestinal and reproductive tracts, stimulates exocrine and endocrine secretion, increases the survival time of neurons, and promotes the proliferation of untransformed and cancer cells.

Specifications

Chemistry
Sequence one letter code
  • HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence three letter code
  • H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
CAS registry number
  • 40077-57-4
Molecular Formula
  • C147H238N44O42S
Molecular Mass/ Weight
  • 3326
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • Human, Porcine
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)