Labeling & detection

Our portfolio includes fluorescent and non-fluorescent dyes, derivatives of streptavidin and biotin, etc.

    281 - 300 of 328

    6-TET, SE [6-Carboxy-2',4,7',7-tetrachlorofluorescein, SE] - 5 mg

    • Cat.Number : AS-81022
    Quick view

    DNP-X acid, SE [6-(2,4-Dinitrophenyl)aminohexanoic acid, SE] - 25 mg

    • Cat.Number : AS-81228
    Quick view

    5(6)-TAMRA-X, SE [6-(Tetramethylrhodamine-5-(and-6)-carboxamido) hexanoic acid, SE] - 5 mg

    • Cat.Number : AS-81127
    Quick view

    Myristolated PKCz, Pseudosubstrate (ZIP) - 1 mg

    • Myr-SIYRRGARRWRKL
    • Cat.Number : AS-63361
    Quick view

    AKT/PKB/Rac-Protein Kinase Substrate [ARKRERTYSFGHHA], Biotinylated

    • Biotin-ARKRERTYSFGHHA
    • Cat.Number : AS-29945-1
    Quick view

    Streptavidin

    • Cat.Number : AS-60659
    Quick view

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01
    Quick view

    PKG Substrate [RKRSRAE], Glasstide

    • RKRSRAE
    • Cat.Number : AS-60298-1
    Quick view

    5(6)-FAM, SE [5-(and-6)-Carboxyfluorescein, SE]

    • Cat.Number : AS-81006-1000
    Quick view

    Protein A, recombinant

    • Cat.Number : AS-72233-5
    Quick view

    5-TAMRA [5-Carboxytetramethylrhodamine] "Formulated"

    • Cat.Number : AS-81121
    Quick view

    5(6)-FAM [5-(and-6)-Carboxyfluorescein] UltraPure Grade Mixed Isomers

    • Cat.Number : AS-81002-1
    Quick view

    5(6)-TAMRA,SE [5-(and-6)-Carboxytetramethylrhodamine, SE]

    • Cat.Number : AS-81124
    Quick view

    6-FAM, SE [6-Carboxyfluorescein, SE]

    • Cat.Number : AS-81008
    Quick view

    5(6)-TAMRA [5-(and-6)-Carboxytetramethylrhodamine] "Formulated"

    • Cat.Number : AS-81120
    Quick view

    HiLyte™ Fluor 594 succinimidyl ester (SE)

    • Cat.Number : AS-81272-1
    Quick view

    Tetramethylrhodamine-5-(and-6) C2 maleimide

    • Cat.Number : AS-81441-5
    Quick view

    5-FAM, SE [5-Carboxyfluorescein, SE]

    • Cat.Number : AS-81007
    Quick view

    6-TAMRA [6-Carboxytetramethylrhodamine]

    • Cat.Number : AS-81122
    Quick view

    CyLyte Fluor 5, acid

    • Cat.Number : AS-89354-5
    Quick view
      281 - 300 of 328