Peptides
We offer custom and catalog peptides with 95% % purity by HPLC unless otherwise specified. For your more demanding project, we produce GMP grade peptides.
681 - 700 of 1100
Elafin - 0.1 mg
- AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
- Cat.Number : AS-61641
26Rfa, Hypothalamic Peptide, rat - 1 mg
- ASGPLGTLAEELSSYSRRKGGFSFRF-NH2
- Cat.Number : AS-61650
Histone H3 (1-21)-GGK(Biotin)-NH2 - 1 mg
- ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
- Cat.Number : AS-61702
681 - 700 of 1100