Catalog

    1 - 20 of 216

    [Arg8]-Vasopressin (AVP) Peptide

    CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    [Cys26]-beta-Amyloid (1-42)

    DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
      1 - 20 of 216