Catalog

    1 - 20 of 38

    Big Gastrin-1, human - 0.5 mg

    • Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2

    Bombesin - 1 mg

    • Pyr-QRLGNQWAVGHLM-NH2

    Ghrelin, human Peptide

    • GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR

    Ghrelin, human, Biotin-labeled - 1 mg

    • Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR

    Ghrelin, rat, mouse Peptide

    • GS-S(n-octanoyl)-FLSPEHQKAQQRKESKKPPAKLQPR

    GIP (1-42), human

    • YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

    GIP (3-42), human - 1 mg

    • EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
      1 - 20 of 38