We use cookies to offer you the best experience on our site. You can find out more about the cookies we use or disable them in the Cookie settings
Catalog
1 - 20 of 42
[Leu31, Pro34]-Neuropeptide Y, human, rat - 1 mg
YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2Calcitonin Gene Related Peptide, CGRP (alpha) (8-37), human - 1 mg
VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2Calcitonin Gene Related Peptide, CGRP (alpha), human
ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)Calcitonin Gene Related Peptide, CGRP (alpha), human, Biotin-LC-labeled - 1 mg
Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)Calcitonin Gene Related Peptide, CGRP (beta), human - 0.5 mg
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)Calcitonin Gene Related Peptide,CGRP (alpha), aCGRP, rat, mouse - 1 mg
SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
1 - 20 of 42