Catalog

    1 - 20 of 42

    [Arg8]-Vasopressin (AVP) Peptide

    CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    Biotin-Oxytocin - 1 mg

    Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)

    Bombesin - 1 mg

    Pyr-QRLGNQWAVGHLM-NH2

    Calcitonin Gene Related Peptide, CGRP (alpha), human

    ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)

    Calcitonin Gene Related Peptide, CGRP (alpha), human, Biotin-LC-labeled - 1 mg

    Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)

    Calcitonin Gene Related Peptide, CGRP (beta), human - 0.5 mg

    ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)

    Calcitonin Gene Related Peptide,CGRP (alpha), aCGRP, rat, mouse - 1 mg

    SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
      1 - 20 of 42