Products
Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.
1 - 20 of 2048
Protease-Activated Receptor-4, PAR-4 Agonist 3, amide, murine - 1 mg
- GYPGKF-NH2
- Cat.Number : AS-60778
520 MMP FRET Substrate 11 - 0.1 mg
- 5-FAM-P-Cha-G-Nva-HA-Dap(QXL® 520)-NH2
- Cat.Number : AS-60578-01
Adrenomedullin (1-52), human - 0.5 mg
- YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
- Cat.Number : AS-60447
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
520 MMP FRET Substrate 12 - 0.1 mg
- 5-FAM-RPKPYA-Nva-WM-K(QXL® 520)-NH2
- Cat.Number : AS-60579-01
Angiotensin I Converting Enzyme 2, ACE-2/Caspase-1 Substrate - 1 mg
- Mca-YVADAPK(Dnp)
- Cat.Number : AS-60758
Biotin-X NTA [Biotin-X nitrilotriacetic acid, tripotassium salt] - 5 mg
- Cat.Number : AS-60655
Renin Inhibitor Peptide, WFML Peptide, rat - 1 mg
- Ac-HPFV-(Sta)-LF-NH2
- Cat.Number : AS-60463-1
1 - 20 of 2048