Products

    21 - 40 of 2149

    [Arg8]-Vasopressin (AVP) Peptide

    CYFQNCPRG-NH2 (Disulfide bridge: 1-6)

    [Cit 2/8/17]-Histone H3 (1-21)-GGK(Biotin)-NH2 - 0.25 mg

    A-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLA-GGK(Biotin)-NH2

    [Cys(HiLyte™ Fluor 647 C2 maleimide)]-Exendin-4 - 50 µg

    C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

    [Cys26]-beta-Amyloid (1-42)

    DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA

    [Gla17,21,24]-Osteocalcin (1-49)

    YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=g-Carboxyglutamic Acid; Disulfide bridge: 23-29)
      21 - 40 of 2149