Blue (<500 nm)

    21 - 26 of 26

    390 MMP FRET Substrate 5 - 1 mg

    • Mca-PLGLEEA-Dap(Dnp)-NH2
    • Cat.Number : AS-62027

    Cathepsin K substrate - 0.1 mg

    • Abz-HPGGPQ-EDDnp
    • Cat.Number : AS-62368

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076
      21 - 26 of 26