Peptides

We offer custom and catalog peptides, GMP grade peptides. Catalog peptides are 95% purity by HPLC unless otherwise specified.

    41 - 60 of 1100

    Cys-beta-Amyloid (1-40) - 1 mg

    • CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23520

    Calcitonin Gene Related Peptide, CGRP (alpha) (8-37), human - 1 mg

    • VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
    • Cat.Number : AS-22857

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-23994

    Adrenomedullin (1-50), rat - 0.5 mg

    • YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
    • Cat.Number : AS-60454

    520 MMP FRET Substrate IV - 0.1 mg

    • QXL® 520-PLGLWArK(5-FAM)-NH2
    • Cat.Number : AS-60568-01

    520 MMP FRET Substrate 15 - 0.1 mg

    • QXL® 520 -γ-Abu-PQGL-Dab(5-FAM)-AK-NH2
    • Cat.Number : AS-60582-01

    520 MMP FRET Substrate 14 - 0.1 mg

    • QXL® 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
    • Cat.Number : AS-60581-01

    Cytochrome C (PCC), Pigeon (88-104) - 1 mg

    • KAERADLIAYLKQATAK
    • Cat.Number : AS-60432-1

    520 MMP FRET Substrate 6 - 0.1 mg

    • QXL® 520-PLGMWSRK(5-FAM)-NH2
    • Cat.Number : AS-60573-01
      41 - 60 of 1100