Catalog

A huge collection of high purity peptides for different research areas such as Diabetes, Cardiovascular, Cell Permeable and Penetrating Peptides, etc.

    41 - 60 of 1093

    Orexin A, bovine, human, mouse, rat - 1 mg

    • Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
    • Cat.Number : AS-24470

    Cys-beta-Amyloid (1-40) - 1 mg

    • CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23520

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-23994

    Renin FRET substrate, Dabcyl/EDANS - 1 mg

    • DABCYL-g-Abu-IHPFHLVIHT-EDANS
    • Cat.Number : AS-24478

    Big Gastrin-1, human - 0.5 mg

    • Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
    • Cat.Number : AS-20747

    Bombesin - 1 mg

    • Pyr-QRLGNQWAVGHLM-NH2
    • Cat.Number : AS-20665

    Parathyroid Hormone (1-34), human - 1 mg

    • SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
    • Cat.Number : AS-20708

    MAPS, Core, 8-Branch - 10 mg

    • (K)4-(K)2-K-A
    • Cat.Number : AS-21006

    Glucagon (1-37), Oxyntomodulin, porcine - 1 mg

    • HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
    • Cat.Number : AS-22455

    Calcitonin, salmon - 5 mg

    • CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
    • Cat.Number : AS-20678

    Suc-Arg-Pro-Tyr-pNA - 5 mg

    • Suc-RPY-pNA
    • Cat.Number : AS-20586

    ACTH (18-39), human (CLIP) - 1 mg

    • RPVKVYPNGAEDESAEAFPLEF
    • Cat.Number : AS-20619

    Galanin, human - 1 mg

    • GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
    • Cat.Number : AS-22431
      41 - 60 of 1093