Products
Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.
1 - 20 of 53
NGR Peptide 1 - 1 mg
- CNGRCGGklaklakklaklak-NH2 (Disulfide bridge: 1-5)
- Cat.Number : AS-60189-1
Aminopeptidase N Ligand (CD13), NGR peptide - 5 mg
- CNGRCG (Disulfide bridge: 1-5)
- Cat.Number : AS-60171-5
Antennapedia Peptide, FAM-labeled - 1 mg
- 5-FAM-RQIKIWFQNRRMKWKK-NH2
- Cat.Number : AS-64212
Anti-BetaGamma (MPS-Phosducin-like protein C terminus)
- AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
- Cat.Number : AS-24177
1 - 20 of 53