Peptides

We offer custom and catalog peptides, GMP grade peptides. Catalog peptides are 95% purity by HPLC unless otherwise specified.

Your selection

    1 - 20 of 216

    Beta-Amyloid (1-11) - 1 mg

    • DAEFRHDSGYE
    • Cat.Number : AS-22819

    ß-Secretase Inhibitor 1 - 1 mg

    • KTEEISEVN-Sta-VAEF (Sta = statine)
    • Cat.Number : AS-23958

    Biotin-Dynorphin A (1-17) Peptide Fragment - 1 mg

    • Biotin-YGGFLRRIRPKLKWDNQ
    • Cat.Number : AS-23978

    [Leu31, Pro34]-Neuropeptide Y, human, rat - 1 mg

    • YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
    • Cat.Number : AS-24366

    Beta-Amyloid (11-22) - 1 mg

    • EVHHQKLVFFAE
    • Cat.Number : AS-23956

    Biotin-beta-Amyloid (17-40) - 1 mg

    • Biotin-LVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23541

    [Lys3]-Bombesin - 5 mg

    • Pyr-QKLGNQWAVGHLM-NH2
    • Cat.Number : AS-22838

    Beta-Amyloid (25-35) • HCl - 5 mg

    • GSNKGAIIGLM • HCl
    • Cat.Number : AS-23212

    ß-Endorphin, human - 1 mg

    • YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
    • Cat.Number : AS-24319

    Orexin A, bovine, human, mouse, rat - 1 mg

    • Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
    • Cat.Number : AS-24470

    Cys-beta-Amyloid (1-40) - 1 mg

    • CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    • Cat.Number : AS-23520

    Biotin-Oxytocin - 1 mg

    • Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
    • Cat.Number : AS-23994

    Bombesin - 1 mg

    • Pyr-QRLGNQWAVGHLM-NH2
    • Cat.Number : AS-20665

    Galanin, human - 1 mg

    • GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
    • Cat.Number : AS-22431

    Beta-Amyloid (22-35) - 1 mg

    • EDVGSNKGAIIGLM
    • Cat.Number : AS-22823

    Neurotensin (8-13) - 5 mg

    • RRPYIL
    • Cat.Number : AS-22964
      1 - 20 of 216