Peptides
We offer custom and catalog peptides with 95% % purity by HPLC unless otherwise specified. For your more demanding project, we produce GMP grade peptides.
1 - 20 of 216
Biotin-Dynorphin A (1-17) Peptide Fragment - 1 mg
- Biotin-YGGFLRRIRPKLKWDNQ
- Cat.Number : AS-23978
[Leu31, Pro34]-Neuropeptide Y, human, rat - 1 mg
- YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
- Cat.Number : AS-24366
Orexin A, bovine, human, mouse, rat - 1 mg
- Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
- Cat.Number : AS-24470
Cys-beta-Amyloid (1-40) - 1 mg
- CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-23520
Biotin-Oxytocin - 1 mg
- Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
- Cat.Number : AS-23994
1 - 20 of 216