Products

Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.

Your selection

    1 - 20 of 41

    Fibrinopeptide A, human - 1 mg

    • ADSGEGDFLAEGGGVR
    • Cat.Number : AS-20735

    Thrombin Substrate S2238 1 mg

    • f-Pip-R-pNA
    • Cat.Number : AS-63776

    Protease-Activated Receptor-1, PAR-1 Agonist 3, amide - 1 mg

    • AF(para-Fluoro)R-Cha-Cit-Y-NH2
    • Cat.Number : AS-65479

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01
      1 - 20 of 41