Products
Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.
241 - 260 of 2053
SensoLyte® Anti-PLP (178-191) IgG Quantitative ELISA Kit (mouse) Colorimetric - 1 kit
- Cat.Number : AS-55523
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ] - 1 mg
- ADEYLIPQQ
- Cat.Number : AS-29942-1
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], Biotinylated - 1 mg
- Biotin-DADE-pY-LIPQQG
- Cat.Number : AS-29972-1
[Pyr11]-beta-Amyloid (11-40) - 1 mg
- Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- Cat.Number : AS-29904-1
SensoLyte® Anti-MOG(35-55) IgG Quantitative ELISA Kit (mouse/rat) Colorimetric - 1 kit
- Cat.Number : AS-54465
Beta-Amyloid (4-42) - 1 mg
- FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- Cat.Number : AS-29908-1
SensoLyte® Anti-Human MOG (1-125) Human IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-H
SensoLyte® Anti-PLP (139-151) IgG Quantitative ELISA Kit (mouse) Colorimetric - 1 kit
- Cat.Number : AS-55524
SensoLyte® Anti-Rat MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55157
SensoLyte® Anti-Mouse MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55156
SensoLyte® Anti-Human MOG (1-125) Mouse IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-M
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-42) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55554
Charybdotoxin - 0.1 mg
- Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
- Cat.Number : AS-28244
241 - 260 of 2053