Products
Explore our selection of amplification and labeling reagents, peptides, proteins, and more. Find also antibodies, assay kits, and other tools for your lab.
41 - 60 of 2051
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled - 0.5 mg
- Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
- Cat.Number : AS-23972
Orexin A, bovine, human, mouse, rat - 1 mg
- Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
- Cat.Number : AS-24470
Glandular Kallikrein Substrate, fluorescent H-D-Val-Leu-Arg-AFC - 10 mg
- vLR-AFC
- Cat.Number : AS-24137
Plasmin Substrate, fluorescent (H-D-Val-Leu-Lys-AFC) - 10 mg
- vLK-AFC
- Cat.Number : AS-24133
Biotin-Oxytocin - 1 mg
- Biotin-CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
- Cat.Number : AS-23994
Renin FRET substrate, Dabcyl/EDANS - 1 mg
- DABCYL-g-Abu-IHPFHLVIHT-EDANS
- Cat.Number : AS-24478
SensoLyte® Anti-Human MOG (1-125) Human IgG Specific ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55153-H
SensoLyte® Anti-PLP (139-151) IgG Quantitative ELISA Kit (mouse) Colorimetric - 1 kit
- Cat.Number : AS-55524
SensoLyte® Anti-Rat MOG (1-125) IgG Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55157
SensoLyte® Anti-Mouse/Rat ß-Amyloid (1-42) Quantitative ELISA Kit Colorimetric - 1 kit
- Cat.Number : AS-55554
Exendin 4, FAM-labeled - 0.5 mg
- FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
- Cat.Number : AS-60280-05
41 - 60 of 2051