Blue (<500 nm)

Your selection

    1 - 20 of 25

    390 MMP FRET Substrate 1 - 1 mg

    • Mca-PLGL-Dap(Dnp)-AR-NH2
    • Cat.Number : AS-27076

    390 MMP FRET Substrate 11 - 5 mg

    • Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
    • Cat.Number : AS-27109

    390 MMP FRET Substrate 2 - 5 mg

    • Mca-PLGL-Dap(Dnp)-AR
    • Cat.Number : AS-27079

    390 MMP FRET Substrate 5 - 1 mg

    • Mca-PLGLEEA-Dap(Dnp)-NH2
    • Cat.Number : AS-62027

    390 MMP Substrate 13, NFF-3 - 1 mg

    • Mca-RPKPVE-Nva-WR-K(Dnp)-NH2
    • Cat.Number : AS-27114

    490 MMP FRET Substrate 10 - 1 mg

    • DABCYL-RPLALWRS-EDANS
    • Cat.Number : AS-27104

    490 MMP Substrate 16 (TNO211) - 1 mg

    • DABCYL-(γ-Abu)-PQGL-E(EDANS)AK-NH2
    • Cat.Number : AS-25350

    ADAMTS-13 FRET Substrate, FRETS-VWF73

    • DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
    • Cat.Number : AS-63728-01

    ADAMTS-4/Aggrecanase FRET Substrate, WAAG-3R - 1 mg

    • Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
    • Cat.Number : AS-60431-1

    Bacterial Sortase Substrate I, FRET - 1 mg

    • DABCYL-LPETG-EDANS
    • Cat.Number : AS-62231

    Cathepsin D and E FRET Substrate - 1 mg

    • Mca-GKPILFFRLK(Dnp)-r-NH2
    • Cat.Number : AS-61793

    Cathepsin K substrate - 0.1 mg

    • Abz-HPGGPQ-EDDnp
    • Cat.Number : AS-62368

    Cathepsin S Substrate - 1 mg

    • Ac-KQKLR-AMC
    • Cat.Number : AS-61859
      1 - 20 of 25